PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn150621
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family BES1
Protein Properties Length: 118aa    MW: 13978.9 Da    PI: 10.8617
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn150621genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF82293.25.9e-29245952
      DUF822  9 wkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlk 52
                wkErEnnkrRER RRaiaaki++GLR+qGn+klpk++DnneVlk
  Achn150621  2 WKERENNKRRERWRRAIAAKIFTGLRSQGNFKLPKHCDNNEVLK 45
                9******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.4E-25245IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MWKERENNKR RERWRRAIAA KIFTGLRSQG NFKLPKHCDN NEVLKLESPL RRSWLGRRRR  60
WHHLSQGYFS PSNLCFMGCV TECNGRYGCD LNFSVTNGDR NDAGRYRYVT AVTDRFF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62042130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50750.12e-10BES1/BZR1 homolog 1